Error: Could not find gene with ID = 'MSMEG1299' and Strain = 'H37Rv'

Error: Could not find gene with ID = 'MSMEG3212' and Strain = 'H37Rv'

Error: Could not find gene with ID = 'MSMEG3296' and Strain = 'H37Rv'

Error: Could not find gene with ID = 'MSMEG0393' and Strain = 'H37Rv'

Error: Could not find gene with ID = 'MSMEG2850' and Strain = 'H37Rv'

Error: Could not find gene with ID = 'MSMEG0252' and Strain = 'H37Rv'

Could not find gene with ID = 'MSMEG1299' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3212' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3212' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3296' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3296' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3296' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0393' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0393' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0393' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2850' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2850' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0252' and Strain = 'H37Rv'

Rv1366A (-)


Species:	M. tuberculosis
Strain:	H37Rv
PATRIC Annotation:	hypothetical protein
Synonyms:
M. smegmatis homologs
M. abscessus homologs
Gene Start:	1539186
Gene End:	1539446
Vulnerability Index (VI):
VI Lower Bound:
VI Upper Bound:

[AlphaFold] [Phyre2] [UniProt] [MycoBrowser] [Orthologs] [U19] [TnSeq DB] [Gaia]

Essentiality:

Call	Condition	Type	Source	Notes
Non Essential	in vitro	TnSeq	[DeJesus et al. (2017)]
Unknown	in vitro	CRISPRi	[Bosch & DeJesus et al. (2021)]

DNA and Protein Sequence help

DNA Sequence

CACCATTTTGCAGAGCCTGTGGGCCAAGAGCTGACGCGTACGGTCGGGGCATCCGCTATGACGAGCGGCCGGAGCAGCTAGCGGCCGGCGTTCACAGCTTCAAGAGCTGGTAGGGGTTATGCAAGACGCTTCAGCGGATCTGGCGATGCATGAAGCCGAGTGGCAACACTGTGCAGAGATCGAATACCCCGGCCAGCGGGCGATGGCGCTTGGCGAGGCGAGCAAGAACAAGGCGACGCAACGACCAAGTTTAGGCTGGAAAGGGCCATCAATGAGGCCGAGTCGGCAGGGGGAGGTGGGTGAGGTGGCTGGCTATGTCGTCGAATACAACCGGCGCACCCACGTGCGTCGCATCACCGAGTTCGCCACCCCGCAAGAAGCGATGGAGCACCGGTTGAAGCTGGAAGCCGAGCGCACCGACAGCAATATCGAGATCGTTGCGCTCGTCAGTAAGTCGTTGGGAACCCTGAAGCAAACGCATTCGCGGTACTTCACTGGTGAAGAGCTGAACGTCGGAAACGGCGCGCGGTAG

Protein Sequence

MRPSRQGEVGEVAGYVVEYNRRTHVRRITEFATPQEAMEHRLKLEAERTDSNIEIVALVSKSLGTLKQTHSRYFTGEELNVGNGAR

Gene not present in the reference CRISPRi library.

Rv1366A (-)

Essentiality:

DNA Sequence

Protein Sequence

Specific References

General References