Could not find gene with ID = 'MSMEG0367' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0367' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3237' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3237' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3237' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0540' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2916' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0415' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0415' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0415' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2520' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1629' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1631' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4527' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4527' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0459' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0459' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2728' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2726' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x70f83caa9e80>>.

Rv2105 (-)


Species:	M. tuberculosis
Strain:	H37Rv
PATRIC Annotation:	transposase
Synonyms:
M. smegmatis homologs	MSMEG2676, MSMEG0724, MSMEG1720, MSMEG1716, MSMEG5096, [+ 5 remaining orthologs]
M. abscessus homologs	MAB2087
Gene Start:	2365473
Gene End:	2365799
Vulnerability Index (VI):
VI Lower Bound:
VI Upper Bound:

[AlphaFold] [Orthologs] [Phyre2] [UniProt] [MycoBrowser] [U19] [TnSeq DB] [Gaia]

Essentiality:

Call	Condition	Type	Source	Notes
Non Essential	in vitro	TnSeq	[DeJesus et al. (2017)]
Unknown	in vitro	CRISPRi	[Bosch & DeJesus et al. (2021)]

DNA and Protein Sequence help

DNA Sequence

CTCGCAACAGCTCACGGGACCTTTTTGAGGATCGCCACTTCAGGTCTTCAACTCGCGGCATTGGCAACGTTTGCGCGGGGCGGCCGGCAGCCACCAAGTCGAGCACTTTGCGGCGGAACTACTCGGGGTAACACTTCGGCACGGACACGGCTCGTTCGACGGACGTCGTGACCAGAAGTCGAGCAAACCGACTCCACTCTAGCTAGTGATACAAGCTTTTTTGTAGCCGCGCGATGAACCGCCCCGGCATGTCCGGAGACTCCAGAAAGGATGGGGTCATGTCAGGTGGTTCATCGAGGAGGTACCCGCCGGAGCTGCGTGAGCGGGCGGTGCGGATGGTCGCAGAGATCCGCGGTCAGCACGATTCGGAGTGGGCAGCGATCAGTGAGGTCGCCCGTCTACTTGGTGTTGGCTGCGCGGAGACGGTGCGTAAGTGGGTGCGCCAGGCGCAGGTCGCGCACGGCCCGGGACCACGACCGAAGAATCCGCTGAGCTGAAGCGCTTGCGGCGGGACAACGCCGAATTGCGAAGGGCGAACGCGATTTTAAAGACCGCGTCGGCGCGGCCGAGCTCGACCGGCCAGCACGCTAA

Protein Sequence

MSGGSSRRYPPELRERAVRMVAEIRGQHDSEWAAISEVARLLGVGCAETVRKWVRQAQVDAGARPGTTTEESAELKRLRRDNAELRRANAILKTASAFFAAELDRPAR

Rv2105 (-)

Essentiality:

DNA Sequence

Protein Sequence

Specific References

General References