Error: Could not find gene with ID = 'MSMEG3604' and Strain = 'H37Rv'

Error: Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x76d0dad4e1b0>>.

Error: Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x76d0da9410d0>>.

Error: Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x76d0da9427e0>>.

Error: Could not find gene with ID = 'MSMEG3321' and Strain = 'H37Rv'

Error: Could not find gene with ID = 'MSMEG3624' and Strain = 'H37Rv'

Error: Could not find gene with ID = 'MSMEG6607' and Strain = 'H37Rv'

Could not find gene with ID = 'MSMEG3604' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x76d0dad4e1b0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x76d0da9410d0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x76d0da9427e0>>.
Could not find gene with ID = 'MSMEG3321' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3624' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3624' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6607' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6607' and Strain = 'H37Rv'

MSMEG2436 (MSMEG2436)


Species:	M. smegmatis
Strain:	MC2-155
PATRIC Annotation:	-
Synonyms:
M. tuberculosis homologs	RVBD2908c
M. abscessus homologs	MAB3228c
Gene Start:	2520258
Gene End:	2520488
Vulnerability Index (VI):
VI Lower Bound:
VI Upper Bound:

[AlphaFold] [Orthologs] [Phyre2] [UniProt] [MycoBrowser] [TnSeq DB] [Gaia]

Essentiality:

Call	Condition	Type	Source	Notes
Unknown	in vitro	CRISPRi	[Bosch & DeJesus et al. (2021)]
Growth Defect	in vitro	TnSeq	[Dragset et al. (2019)]

DNA and Protein Sequence help

DNA Sequence

CAGCCCACCGAGCCGCCAGATCACCGGTGACTGGCAGAAGTTCAAGGGCGCGCCGAGGGCACCCTGAAGGTCAAGGAGCCCAAGCCGTCCAAGCTGGATCTGTTCAACGCAGCCCTGGCCGAGGCCGAGAGCGGCACCACCGCGGCCGCCACCACGCCCAAGAAGAAGAAGGCGCCGAAGAAGGACGAGGGGCGCCGGCTGAGGCCGCCGAGGCTCCGGCTGAAGCCGCCGACGCCGCAAGCGAGAGCTGAGCACCGCAGTGAGTTCAGTCGTGGTCGACGCCGTCGAGCACCTGGTCCGCGGGATCGTCGACAACCCTGACGATGTGCGTGTCGACATGGTCACCAACCGCCGGGGACGGACCGTCGAGGTGCATGTGCACCCCGACGACCTCGGCAAGGTGATCGGCCGTGGCGGCCGTACCGCCACGGCGCTGCGCACCCTGGTCGCCGGGATCGGCGGCCGGGGCATCCGCGTCGACGTTGTCGACACCGACCAGTAA

Protein Sequence

VVDAVEHLVRGIVDNPDDVRVDMVTNRRGRTVEVHVHPDDLGKVIGRGGRTATALRTLVAGIGGRGIRVDVVDTDQ

Gene not present in the reference CRISPRi library.

MSMEG2436 (MSMEG2436)

Essentiality:

DNA Sequence

Protein Sequence

Specific References

General References