Ms4607 (MSMEG4607)

Could not find gene with ID = 'MSMEG3054' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6208' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1530' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5789' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2416' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1184' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5617' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1605' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1656' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2470' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1135' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2961' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4962' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0317' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1824' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3612' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4814' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4957' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3623' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6253' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2962' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3525' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4919' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1819' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa44e592480>>.

MSMEG4607

ms4607

M. smegmatis · MC2-155

[AlphaFold] [Orthologs] [Phyre2] [UniProt] [MycoBrowser] [TnSeq DB] [SeqHub]

MC2-155 Coordinates:	4692856 – 4693002
Vulnerability Index (VI):
M. tuberculosis homologs
M. abscessus homologs

DNA and Protein Sequence help

DNA Sequence

>ms4607_MSMEG4607_dna

CCTTGGGCATCGCCTCCACTTGCGCCGCGTCCATGGTCACCCCGCAAGGCGCGGCCAAAAAGGCGGTCGCAGAGGGCGCCGAACTCGCCGTCGAACAACTGGGCAAGCACGCCGATACGTTATCGACGTCGCCAAAGCCGCCCCCACCCCACCCGCCCAACTCGCCGATGAGATCGCAGCACCGCAAAACCCCCAGTGAAACCGGGGGTTTCACCAAAGACGCCCCGCCCGCGAAGACAGCCGAGGCCACACCCACAGCTGCGACCCACAACGCGTCCGGAGCGTCGGCAAAGGGCCTCACCGCACGCAGTGGGAAAACAGTTGGGCACAGCACGCGGCGATCGCCGAAGAAAGACAAGAAGAGCAAGAAGCACCACAAGAAACCCGGCAAGTGA

Protein Sequence

>Ms4607_MSMEG4607_protein

MLPRASAKLPRPHRTQSPVGKQLGIATSTRRSPKKDKKSKKHHKKPGK

Essentiality:

Call	Condition	Type	Source	Notes
Unknown	in vitro	CRISPRi	[Bosch & DeJesus et al. (2021)]
Unknown	in vitro	TnSeq	[Dragset et al. (2019)]

You do not have permission to view notes.