Error: Could not find gene with ID = 'MSMEG0185' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG6301' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG2153' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG0465' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG3270' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG0885' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG3142' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG5201' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG4113' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG0239' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG4802' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG2049' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG3602' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG2849' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG0906' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG1985' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG0903' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG0936' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG2467' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG4875' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG0713' and Strain = 'H37Rv'
Error: Could not find gene with ID = 'MSMEG0902' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG0185' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG6301' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG2153' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG0465' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG3270' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG0885' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG3142' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG5201' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG4113' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG0239' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG4802' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG2049' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG3602' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG2849' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG0906' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG1985' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG0903' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG0936' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG2467' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG4875' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG0713' and Strain = 'H37Rv'
-
Could not find gene with ID = 'MSMEG0902' and Strain = 'H37Rv'
glpR
mL0185
M. leprae
·
TN
| TN Coordinates: |
250221 – 251249 |
| Vulnerability Index (VI): |
|
help_outline
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence
help
DNA Sequence
C
TTGCTGCGCCGCTACCTCGAGGTTGATCGAGCGTGGCGTGACCAC
CTGCTGATGGCCCTCACGATCGAAGAGGTATCCGGGTCGGTTACGTCGAACCTGGTACGGGCCGGTC
GTGCCAGCTGGCTCTAAATCGTACGTATGGTGAAACA
CTGCCTACCGCCGTGTGACTGATGTGACACGAGTAAATAATTTTTG
ATGCTTGTCAGCTGTAAATTACAGGTGTGTAATTGTTGTTGGTACCATTG
ATCCTGCCGGGTTGGTCACCTATTGGCC
TTGCCGGGGAAAGGAACAGGTCATT
ATGCCGAGCATCCCCCAATCGCTGCTGTGGATTTCGTTGGTGGTGCTGTGGCTTTTCGTGCTGGTGCCGATGTTGATCAGCAAACGTGACGTTGTTCGCCGCATCAGTGATGTGGCATTGGCGACTCGGGTGCTAAACGGTGTTGCCGGTGCCCGACTACTCAAGCGAGGTGGTCCCGCCACGGGGCATCGCAGCGACCACAATTGGGAGCTGGACGAGGACTGGCGGCAAAACCCGGTCGATGGTGAATTCGCTGACGCTGACCAGGACATAGGTGAAGAACAGGACCAAAACGTCGATGATACGCAGCGTACACGTCCGGTGGTCATGGAGGTTGCGGTGGCTGAGCTCACCGGCACCGACTACCTGGATGTCGATGTTGTCGAAGATTCGGTGGCCCTGCCGATTGAGGACAGTGCTGACGTAACTGAGTCCGTCCTGCTAGCGGTCGGTGAAGGCGGATCGCCGGGTGAAGAAGCTGAGGCTGAGCAACGGCAAAGTGACCGGTACGGATACGTCGACGCATCGTCGGGTCTGGGACTCGAGCAGAAGGACGACAAGTCGCCGGTGCCAGTAGCGCCGACTGTCTCGCGGCAGCGTCGGTACGACACCAAGACCGCCACCGCGGTCAGTGCACGCAAGTACGCGTTTCGTAAAAGGGTGCTGATGGTTATGGCGATCATCTTGGTTGGCTCTGCCGCAGCGGCGTTCGAAGTGGATTCGAATGCCTGGTGGATTTGCGGTAGCTCCACCACTGTCACAGTGCTTTATCTGGCCTATTTGCGCCGGCAAACTCGGATTGAAGAGAAAGTGCGTAGCCGTCGGATGCATCGGATAGCACGTGCCCGGGTCGACGTGGAAAACGCGCATGACCGCGAATTTGACGTGGTTCCATCGCGGCTGCGGCGTCCAGGCGCAGTGGTCTTGGAAATCGATGACGAGGACCCTATCTTCGAACACCTGGACTACGAGATGCCGATTCGTACGTTTGGCTGGCCCAGGGACCTACCAAGAGCCGTGGGCCAGTAA
Protein Sequence
MPSIPQSLLWISLVVLWLFVLVPMLISKRDVVRRISDVALATRVLNGVAGARLLKRGGPATGHRSDHNWELDEDWRQNPVDGEFADADQDIGEEQDQNVDDTQRTRPVVMEVAVAELTGTDYLDVDVVEDSVALPIEDSADVTESVLLAVGEGGSPGEEAEAEQRQSDRYGYVDASSGLGLEQKDDKSPVPVAPTVSRQRRYDTKTATAVSARKYAFRKRVLMVMAIILVGSAAAAFEVDSNAWWICGSSTTVTVLYLAYLRRQTRIEEKVRSRRMHRIARARVDVENAHDREFDVVPSRLRRPGAVVLEIDDEDPIFEHLDYEMPIRTFGWPRDLPRAVGQ
No essentiality data available for this gene.
You do not have permission to view notes.