ML0292c
mL0292c
Hypothetical protein
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 373605 – 373844
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL0292c_ML0292c_dna
GTGCCTGCGTACGGAACAGCTTCCGGTAGAAGAATTCTCGAGGCCATACTAATTGCTTCCGATATCGATATCATAGTTTACCACCTCCTGACTAGCAAGGTGCATCAGTACCACATTGCCTACCACGAATTTGGCAATGTGCTTGCTGGCAACCACCAGGTCGTATCCGAAAATTATGCACTACATCTGCTCGCGTCGAGTATCGATCCCATCCCTCGTGCGAAGTATCCTGGACCGTAG

Protein Sequence 

>ML0292c_ML0292c_protein
VPAYGTASGRRILEAILIASDIDIIVYHLLTSKVHQYHIAYHEFGNVLAGNHQVVSENYALHLLASSIDPIPRAKYPGP

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding ML0292c with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

0 proteins show strong predicted evidence for PPIs

0 show intermediate predicted evidence for PPIs

7 show weak predicted evidence for PPIs

View all pooled AlphaFold results for ML0292c

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.