secG
mL0577
Probable protein-export membrane protein (Translocase subunit) SecG
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 699951 – 700184
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL0577_secG_dna
TGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGTGTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGTTCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAGAACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCATTATCGGCGTAGCCCTGCTAACTAAATACCGTTAGC

Protein Sequence 

>ML0577_SecG_protein
WSWPCRSPWLSPASS_CC_YFCTVRRVVACRRCSAVACNPVCPGRRWWRRTWTG_RCSSPESGWYPLSA_PC_LNTVS

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding SecG with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

1 protein shows strong predicted evidence for PPIs

9 show intermediate predicted evidence for PPIs

98 show weak predicted evidence for PPIs

View all pooled AlphaFold results for SecG

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.