whiB7
mL0639
Probable transcriptional regulatory protein WhiB7
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 771723 – 771992
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL0639_whiB7_dna
TGTTGACACTGACAATCCCTAAACAGACGCTGCCCGGGTTGCCGTGCCATGCCGACACCTCCGACCTATGGTTCGCTGAGACCCCAGCAGACCTGGAGTGCACCAAAACGCTCTGCGCGAACTGCCCGATCCGCCGCCCGTGCCTGGAGGCAGCGATGGAACGGGCCGAACCCTGGGGTGTGTGGGGCGGTGAAATTTTCGATCGAGGCTTGATCGTGAGTCGCAAACGTCCTCGTGGACGACCGTGCAACGATGTCGTCGTTGTTTAGA

Protein Sequence 

>ML0639_WhiB7_protein
C_H_QSLNRRCPGCRAMPTPPTYGSLRPQQTWSAPKRSARTARSAARAWRQRWNGPNPGVCGAVKFSIEA_S_VANVLVDDRATMSSLFR

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding WhiB7 with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

0 proteins show strong predicted evidence for PPIs

12 show intermediate predicted evidence for PPIs

38 show weak predicted evidence for PPIs

View all pooled AlphaFold results for WhiB7

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.