ML1067
mL1067
conserved hypothetical protein
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 1231780 – 1232007
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL1067_ML1067_dna
CTCGGCGCCGAATGGGTCCGCGAGGGCGGGCCAGCTCGAGTTTGGAGGGAGCACACGATGGCGGCGATGAAGCCTCGGACCGGAGACGGTCCTCTGGAAGCGACGAAGGAGGGGCGAGGTATCGTGATGCGCGTACCATTAGAGGGTGGCGGACGACTCGTTGTCGAGTTGACACCGGACGAAGCCGCCGCTCTGAGTGACGAACTTAAGGGCGTCACCAGCTAAACC

Protein Sequence 

>ML1067_ML1067_protein
LGAEWVREGGPARVWREHTMAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTPDEAAALSDELKGVTS_T

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding ML1067 with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

0 proteins show strong predicted evidence for PPIs

2 show intermediate predicted evidence for PPIs

50 show weak predicted evidence for PPIs

View all pooled AlphaFold results for ML1067

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.