ML1188c
mL1188c
hypothetical protein
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 1390598 – 1390858
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL1188c_ML1188c_dna
CTGTTGCCGCGCCAGGAAGCGCTCGTCGAACCGTTAAACGTCAGCTTGCTCTCATTTCGGGAAGCGCTGCAGATCATGGACACTGAGAGGCTAATCTCGTTACGGCGAGGCAACCGTGGCAGCGTCGTTGTGCACACACCAACCAGGACCAGCGCCGCTTACATGCTTGGTTTACTGCTGCAGAGTAAGTCAATCGCGCTCGCCGACCTCGGCGCGGCATTACAGGAACTCGAACCTGCCTGCGCCGCACTGGCAGCCCAG

Protein Sequence 

>ML1188c_ML1188c_protein
LLPRQEALVEPLNVSLLSFREALQIMDTERLISLRRGNRGSVVVHTPTRTSAAYMLGLLLQSKSIALADLGAALQELEPACAALAAQ

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding ML1188c with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

1 protein shows strong predicted evidence for PPIs

15 show intermediate predicted evidence for PPIs

55 show weak predicted evidence for PPIs

View all pooled AlphaFold results for ML1188c

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.