pup
mL1321
conserved hypothetical protein
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 1575497 – 1575688
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL1321_pup_dna
CTCAGGAGCAGACTAGGCGTGGTGGTGGAGGTGATGACGATGAGTTCACCAGCAGCACGTCTGTGGGCCAGGAGCGTCGCGAGAAGCTGACTGAGGAGACCGACGATTTGCTCGACGAAATTGACGATGTCCTTGAGGAGAATGCGGAAGACTTTGTTCGCGCGTACGTACAAAAGGGCGGACAGTGACCCG

Protein Sequence 

>ML1321_Pup_protein
LRSRLGVVVEVMTMSSPAARLWARSVARS_LRRPTICSTKLTMSLRRMRKTLFARTYKRADSDP

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding Pup with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

2 proteins show strong predicted evidence for PPIs

1 shows intermediate predicted evidence for PPIs

33 show weak predicted evidence for PPIs

View all pooled AlphaFold results for Pup

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.