rpmI
mL1395
Probable 50S ribosomal protein L35 RpmI
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 1676419 – 1676613
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL1395_rpmI_dna
CCAAGGCCAAGACCCACAGTGGGGCGTCGAAGCGGTTCCGGCGCACCGGTACCGGGAAGATCGTCCGTCAGAAAGCCAATCGTCGGCATCTGTTCGAGCATAAGCCGAGCACTCGTACCCGGCGACTGGATGGACACACGCGGGTTTCAGCCAACGACACCCAACGGGTCAATTCACTGCTGAACGGCTGACCAG

Protein Sequence 

>ML1395_RpmI_protein
PRPRPTVGRRSGSGAPVPGRSSVRKPIVGICSSISRALVPGDWMDTRGFQPTTPNGSIHC_TADQ

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding RpmI with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

1 protein shows strong predicted evidence for PPIs

10 show intermediate predicted evidence for PPIs

57 show weak predicted evidence for PPIs

View all pooled AlphaFold results for RpmI

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.