ML1668B
mL1668B
Conserved hypothetical protein
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 2012870 – 2013061
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL1668B_ML1668B_dna
TTGGGTGGCACATGCAACTCGGTAATATCGTGATTCCCAAGCAGGTGAACCCCTCACGGATTGCGAGCAACTTCGACGTGTCCGAGTTCAAACTCAGCGCCGCGGAAATGGCATCGATCTCCTCGATCGATGACCGAACCCGGCTTGAACGCAACCCATGCACCTTCGATTTCACAGGCAGGTGAAATGATG

Protein Sequence 

>ML1668B_ML1668B_protein
LGGTCNSVIS_FPSR_TPHGLRATSTCPSSNSAPRKWHRSPRSMTEPGLNATHAPSISQAGEMM

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding ML1668B with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

0 proteins show strong predicted evidence for PPIs

10 show intermediate predicted evidence for PPIs

54 show weak predicted evidence for PPIs

View all pooled AlphaFold results for ML1668B

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.