| TN Coordinates: | 2241944 – 2242246 |
|---|---|
| Vulnerability Index (VI): |
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence
help
DNA Sequence
>mL1861c_rplW_dnaCGGCCTGATGGCAACTATCGCTGACTCCCGCGACATCATCCTGGCCCCGGTCATTTCGGAGAAGTCTTATGGGCTGCTGGACGACAATGTGTACACATTCGTGGTGCATCCCGATTCGAACAAGACGCAGATCAAGATCGCTATCGAGAAGATTTTCTCAGTCAAGGTCGCATCGGTAAATACCTCTAATAGGAAGGGTAAGTGCAAGCGCACCAGGACTGGATTCGGTAGGCGCAAGAACACTAAGCGTGCCATCGTCACCCTGGCGCCGGGCAGCAAGTCGATTGACCTGTTCGGAACACC
Protein Sequence
>ML1861c_RplW_proteinRPDGNYR_LPRHHPGPGHFGEVLWAAGRQCVHIRGASRFEQDADQDRYREDFLSQGRIGKYL__EG_VQAHQDWIR_AQEH_ACHRHPGAGQQVD_PVRNT
No essentiality data available for this gene.
AlphaFold Protein Interactions
Protein–protein interactions (PPIs) were predicted by co-folding RplW with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).
3 proteins show strong predicted evidence for PPIs
10 show intermediate predicted evidence for PPIs
You do not have permission to view notes.