ML2091
mL2091
hypothetical protein
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 2487716 – 2487901
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL2091_ML2091_dna
GCCCTGACCTGGTTGACATCTGGACCGGCGATCGTTGCGGCGAGCAAGGCGCGTTGGCGTTATGCCTGGCCGGCAAGGCCCGGGTGGACATCAGGAACTTCCGGGTCGTGGACACCGTCTGCACCAGTGATGAGTTCATGGTCAGACTGCTCGACGGGTTATGGGGATATGGCTTATGAAGCGCTG

Protein Sequence 

>ML2091_ML2091_protein
ALTWLTSGPAIVAASKARWRYAWPARPGWTSGTSGSWTPSAPVMSSWSDCSTGYGDMAYEAL

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding ML2091 with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

3 proteins show strong predicted evidence for PPIs

10 show intermediate predicted evidence for PPIs

39 show weak predicted evidence for PPIs

View all pooled AlphaFold results for ML2091

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.