ML2569A
mL2569A
SMALL SECRETED PROTEIN
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 3065276 – 3065449
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL2569A_ML2569A_dna
GATCGTTGCGCCCGCAGCCGCCAGCGTAGTAGTTGGTCTGTTGCTTGGCGCTGCCACAATCTTCGGGATGACATTGATGGTGCAGCAGGACACAAAGCCACCACTGCCCGGGGGCGATCCGCAGTCCTCAGTACTCAACCGGGTCGAGTACGGCAACCGTACCTAATCCGGCGA

Protein Sequence 

>ML2569A_ML2569A_protein
DRCARSRQRSSWSVAWRCHNLRDDIDGAAGHKATTARGRSAVLSTQPGRVRQPYLIRR

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding ML2569A with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

1 protein shows strong predicted evidence for PPIs

5 show intermediate predicted evidence for PPIs

67 show weak predicted evidence for PPIs

View all pooled AlphaFold results for ML2569A

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.