ML2666c
mL2666c
hypothetical protein
M. leprae · TN
[TnSeq DB] [SeqHub]
TN Coordinates: 3193715 – 3193969
Vulnerability Index (VI):
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence 

>mL2666c_ML2666c_dna
CCGGTGTGAATGGCGTGGCTGGAGCAGTGGAAGCTGCACCCCGGGCCCTCGTCGTCGACGAAGAACTCGACGACGTCAGGCAACACGGCGGTCACTACGCAGGTAAGGTCGGCGGCCCTCGCCGAACGAAAACTCGGCGGGGGAATGTCTATCTCGTGCACCGCACCGCCGCTGCTGGTGTCTTCGCCGGAGGTTGATGCCGTCTGTGTGAAAATCGGTCACTATCTCGCCACGACTGTGCAGCGGCATATAGAC

Protein Sequence 

>ML2666c_ML2666c_protein
PV_MAWLEQWKLHPGPSSSTKNSTTSGNTAVTTQVRSAALAERKLGGGMSISCTAPPLLVSSPEVDAVCVKIGHYLATTVQRHID

No essentiality data available for this gene.

AlphaFold Protein Interactions

Protein–protein interactions (PPIs) were predicted by co-folding ML2666c with every other protein in the M. leprae proteome using a pooled-AlphaFold3 based approach (Horia et al.). The size-corrected interface predicted template modeling (sciPTM) score indicates confidence in the predicted interaction: weak evidence (sciPTM > 0.05), intermediate evidence (sciPTM > 0.2), or strong evidence (sciPTM > 0.4).

0 proteins show strong predicted evidence for PPIs

1 shows intermediate predicted evidence for PPIs

14 show weak predicted evidence for PPIs

View all pooled AlphaFold results for ML2666c

Use of these data is subject to the AlphaFold Server Output Terms of Use.

You do not have permission to view notes.