fabG
ms0294
-
M. smegmatis · MC2-155
MC2-155 Coordinates: 325317 – 326060
Vulnerability Index (VI): 0.1980
M. tuberculosis homologs Rv2857c, fabG1, Rv0484c, Rv0851c, fabG2, [+ 14 remaining orthologs]
M. abscessus homologs MAB4023c, MAB0073c, MAB4022c, MAB0827, MAB0952, [+ 32 remaining orthologs]
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence

>ms0294_fabG_dna
CGATCCTGCGGTCGAGGCGGAATCCGCTGCCACCGAGGAGGTCACCATCGTCCTGGGGCGCACCACCGTCACACAGCCCTACCGGGCCGGTACGACGCTGCTGCAGACCGCCCGACTGGCCGGGCTCAAGGCCCCGTCCTCATGTGAGGTCGGCACGTGCGGGACGTGCATCGGACAGGTGGTGGAAGGCAGTGCACGGCTGTTGAACAACGACGCGCTCGACGACGACGAGATCGCCGAGGGCTGGGTGGTGACGTGTCAGGCACTGCCCACGAGTCACACGGTGAAGGTGGTGTACGAATGAACCGGGTGGCGGTGGTGACCGGTGGCGCGTCGGGCATGGGTGAGGCGACCTGCCACGAACTCGGCAGGCGCGGCCACAAGGTCGCGGTGCTCGACGTCGATGTCGATGCCGCACAACGCGTCACCGACCATCTCCGATCCGAGGGCGTGACCGCGTTCGCGGTAGGCGCCGATGTGACCGACCGTGCCGCGGTCGAGGAGGCATTCGCCAAGGTCCGCAGCGAGCTGGGCGCCGTCGGCATCCTGGTCACCAGCGCGGGCATGTTCGGCTACGCGTCGTTCGCCGACATCACCGAACAGTCGTGGGCACAGATGATCGACGTGAACCTCAGCGGCACGTTCCGGTGCTGTCAGGTCGCGCTGCCCGACATGGTGGACGCCGGCTGGGGCCGCATCGTGCTGATCTCGTCGTCCAGCGCGCAGCGCGGAACGCCCTTCGCCGCGCACTACGCGGCATCCAAGGGCGCGCTGTTGACGTTGACCAAATCCCTTGCGCGCGAATACGCCAAGCACGGCATCACGGTGAACAACATTCCACCGTCGGGTATCGAGACGCCCATGCAGCACGCATCGCAGGCCGCGGGGTACCTTCCGCCCAACGAAACCATCGCCGCCAACATCCCGCTCGGCAGGCTCGGCGCACCGGCCGACATCGCCGCGGCAGTGGGATTCCTGTGCTCGGAAGAGGCCGGCTTCATCACGGGGCAGACCCTCGGCGTCAACGGCGGCTCGGTCATGTGA

Protein Sequence

>Ms0294_FabG_protein
MNRVAVVTGGASGMGEATCHELGRRGHKVAVLDVDVDAAQRVTDHLRSEGVTAFAVGADVTDRAAVEEAFAKVRSELGAVGILVTSAGMFGYASFADITEQSWAQMIDVNLSGTFRCCQVALPDMVDAGWGRIVLISSSSAQRGTPFAAHYAASKGALLTLTKSLAREYAKHGITVNNIPPSGIETPMQHASQAAGYLPPNETIAANIPLGRLGAPADIAAAVGFLCSEEAGFITGQTLGVNGGSVM

Essentiality:

Call Condition Type Source Notes
Non Essential in vitro CRISPRi [Bosch & DeJesus et al. (2021)]
Non Essential in vitro TnSeq [Dragset et al. (2019)]
Vulnerability Assessment help
[Full list of passaging experiments]

Experiment (PMID: 34297925): We designed an M. tuberculosis CRISPRi library (RLC12) to target all annotated Mtb genes with single guide RNAs (sgRNAs) of varying predicted knockdown efficiencies. In parallel, we constructed a M. smegmatis CRISPRi library (RLC11) to target all annotated Msmeg genes, similar to the Mtb sgRNA library. RLC12 was transformed into M. tuberculosis H37Rv; RLC11 into M. smegmatis mc2-155. We passaged both CRISPRi libraries for nearly 30 generations in the presence or absence of the CRISPRi-inducer anhydrotetracycline (ATc). At the indicated timepoints, genomic DNA was harvested and the representation of individual sgRNAs was counted using Illumina sequencing. Here, we show sgRNA log2 fold-change values (L2FC) (plus versus minus ATc) over consecutive generations for sgRNAs targeting the gene you selected. sgRNAs are color-coded based on their predicted strength from blue (strength=0; weak) to red (strength=1; strong).

In order to quantify gene vulnerability, data were subsequently analyzed with a hierarchical model at the sgRNA level (two-line model) and gene level (Hill curve). The vulnerability quantification is shown below. [More information]

M. smegmatis Reference Fitness Experiment M. tuberculosis H37Rv Reference Fitness Experiment M. tuberculosis HN878 Reference Fitness Experiment
 
 
M. smegmatis Gene-Level Logistic Regression M. tuberculosis H37Rv Gene-Level Logistic Regression (Most similar ortholog) M. tuberculosis HN878 Gene-Level Logistic Regression (Most similar ortholog)
 
Vulnerability Index (VI) 0.1980 0.8760
VI Lower Bound -0.3540 -0.5570
VI Upper Bound 0.9720 3.1980

You do not have permission to view notes.