Ms1224 (MSMEG1224)

Could not find gene with ID = 'MSMEG2370' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3896' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1603' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1229' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6816' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3315' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1684' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0355' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48cef31d0>>.
Could not find gene with ID = 'MSMEG6669' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6241' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1799' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5034' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48ce8f170>>.
Could not find gene with ID = 'MSMEG6566' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5230' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1272' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0221' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4059' and Strain = 'H37Rv'

MSMEG1224

ms1224

M. smegmatis · MC2-155

[AlphaFold] [Orthologs] [Phyre2] [UniProt] [MycoBrowser] [TnSeq DB] [SeqHub]

MC2-155 Coordinates:	1292948 – 1293064
Vulnerability Index (VI):
M. tuberculosis homologs
M. abscessus homologs	MAB0591

DNA and Protein Sequence help

DNA Sequence

>ms1224_MSMEG1224_dna

GCCACCTCGAAATCCAGTGCGACCTGGCCGCCGATGACCATCGCCTTCGCAGCAGAGCTCAGCATCGGTATGAGCTGATCCGAGATGGGCCAGGATCACCACCCGTCTTTGCGGGCGACCTGCACCGCCACCGCGCCCGAGGCAGTGCGCACACGTACGCCACCGCACGAACCTACCCTGTTAGTACCCCAAAACACCCACCCGCCAGCGCAACACCGCAGGTCAAACGACTACCGGCCCCCAAAACCGGCCGACATGTCCAAACTCAGGCGTGTGGATCGTCGGGGAGCTCACCGACTGGGTCGGGCACCCGCCGGAGCAACTCGCTGCGATGCGCCAGGGGCTCGAGGAGCTCCGGCGCAAGGGGCTGGCGGTCATCTATGACTAG

Protein Sequence

>Ms1224_MSMEG1224_protein

VWIVGELTDWVGHPPEQLAAMRQGLEELRRKGLAVIYD

Essentiality:

Call	Condition	Type	Source	Notes
Unknown	in vitro	CRISPRi	[Bosch & DeJesus et al. (2021)]
Non Essential	in vitro	TnSeq	[Dragset et al. (2019)]

You do not have permission to view notes.