MSMEG2341
ms2341
-
M. smegmatis · MC2-155
MC2-155 Coordinates: 2422408 – 2422818
Vulnerability Index (VI): 0.6740
M. tuberculosis homologs Rv2044c
M. abscessus homologs
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence help

DNA Sequence

>ms2341_MSMEG2341_dna
TCGTGATGCGGATCGTCGACGGCGAAGGCGCCGGGAGCATCGTCGAGACGCACGCCACGCCGCTCGGACCCGGCACAGACGGACGCCCCCGCACCGCCGTGGTGGAAGCCGTCGTCGCGCAATCGGATCGGGCCGGTTTCCGTCACGCTCGACGCGCCGCGGCCTTGATCACGCCGCTGATGCGGCATGCCGCGAACCGCTTGTGGCGTGATGACCTGGTGTACGCGGAGCGGCGGTATCAGATTCGGCATCACCAGCGAGATCACCGCCGCACCACCGGACAGGGCCCATAATCGGTGCATGAAGAAGGCGTACACCGCGCTCGTGGCGATCACGGTCGGTGCACACTTCGGTTACCTGTTGTATCTGCCGAGCGGCGGATTCCTCGCGCTGCGCTGGCCCCGCACCCTGGCGTTCCATGTGCCGACGGTGATCTGGGGCGCTTTCGTCGTCGCGCTACGGCTGCGCTGCCCGCTCACACACCTGGAGCAGTGGGCACGCGTGCGGGCCGGGCTCAAGCCGCTGCCCGCGGACGATTTCATCGACCACTACGCCGACGGTGTGCTCTACCCGGCCAACCGCACCGGTGCCGCACAGGCCGCCGCGTTCACCGCGGCCGCGCTCTCCTGGGTGCTGCTGTTCGCCAGGCGCCGTCGCATCACGAGTGCACTCACATCCGCATCTCGGATGAAAACACCTGCTGCTCGATGA

Protein Sequence

>Ms2341_MSMEG2341_protein
MKKAYTALVAITVGAHFGYLLYLPSGGFLALRWPRTLAFHVPTVIWGAFVVALRLRCPLTHLEQWARVRAGLKPLPADDFIDHYADGVLYPANRTGAAQAAAFTAAALSWVLLFARRRRITSALTSASRMKTPAAR

Essentiality:

Call Condition Type Source Notes
Non Essential in vitro CRISPRi [Bosch & DeJesus et al. (2021)]
Non Essential in vitro TnSeq [Dragset et al. (2019)]
Vulnerability Assessment help
[Full list of passaging experiments]

Experiment (PMID: 34297925): We designed an M. tuberculosis CRISPRi library (RLC12) to target all annotated Mtb genes with single guide RNAs (sgRNAs) of varying predicted knockdown efficiencies. In parallel, we constructed a M. smegmatis CRISPRi library (RLC11) to target all annotated Msmeg genes, similar to the Mtb sgRNA library. RLC12 was transformed into M. tuberculosis H37Rv; RLC11 into M. smegmatis mc2-155. We passaged both CRISPRi libraries for nearly 30 generations in the presence or absence of the CRISPRi-inducer anhydrotetracycline (ATc). At the indicated timepoints, genomic DNA was harvested and the representation of individual sgRNAs was counted using Illumina sequencing. Here, we show sgRNA log2 fold-change values (L2FC) (plus versus minus ATc) over consecutive generations for sgRNAs targeting the gene you selected. sgRNAs are color-coded based on their predicted strength from blue (strength=0; weak) to red (strength=1; strong).

In order to quantify gene vulnerability, data were subsequently analyzed with a hierarchical model at the sgRNA level (two-line model) and gene level (Hill curve). The vulnerability quantification is shown below. [More information]

M. smegmatis Reference Fitness Experiment M. tuberculosis H37Rv Reference Fitness Experiment M. tuberculosis HN878 Reference Fitness Experiment
 
 
M. smegmatis Gene-Level Logistic Regression M. tuberculosis H37Rv Gene-Level Logistic Regression (Most similar ortholog) M. tuberculosis HN878 Gene-Level Logistic Regression (Most similar ortholog)
 
Vulnerability Index (VI) 0.6740 0.7130
VI Lower Bound -0.0040 -0.4400
VI Upper Bound 1.6010 2.4590

You do not have permission to view notes.