| MC2-155 Coordinates: | 6937486 – 6937740 |
|---|---|
| Vulnerability Index (VI): | |
| M. tuberculosis homologs | |
| M. abscessus homologs |
DNA Sequence
>ms6891_MSMEG6891_dnaACCGACGAAGCACACTGGATCATCTACGAGCGGTGGGAATCTGTTGAGCACGACGAGGCATACCGGGCGTTTCGTGCGGGCGAAGGAAAGATCGATGATCTGCCGCCGCTGCTGGCCGCACCACCGGTCAAGACCCGCTACCTCGATACCGAGATCTGAAGGGACCTTGATCGCGCCCCGCTCAGCCGACCGCTCGCGCTGGGTACCTATCGTCAGCGCATGACCGACCGCGGACACGCAGTCGTCATCCGCTCCGAGGGGGTTGCAGACCCAGGCCGAGCCACGTTGGCTCAGGCTCGTTGTGCACCTCTGGTGTCGGATGTCCGCGCGACATCTGCGGGTGCTGACCCGAGAATCAACCGGACGGAGTTACCCGCGCCGACATCATGGGGACGGCTGCATGACACCCGCTAAAGCAACCGGTAAAGAACGTCGACTTCTGGAATCGGTTTCAGCTCGCCTGTGCGCGACACCAACTCAACGAGTGGTTCTGGGTAGAACGACACTCAGGTGTTGCCTACTACGAATTGGCGGACGTCCTGGCAGCCAAGTAA
Protein Sequence
>Ms6891_MSMEG6891_proteinLCTSGVGCPRDICGC_PENQPDGVTRADIMGTAA_HPLKQPVKNVDFWNRFQLACARHQLNEWFWVERHSGVAYYELADVLAAK
Essentiality:
| Call | Condition | Type | Source | Notes |
|---|---|---|---|---|
| Non Essential | in vitro | CRISPRi | [Bosch & DeJesus et al. (2021)] | |
| Unknown | in vitro | TnSeq | [Dragset et al. (2019)] |
Experiment (PMID: 34297925): We designed an M. tuberculosis CRISPRi library (RLC12) to target all annotated Mtb genes with single guide RNAs (sgRNAs) of varying predicted knockdown efficiencies.
In parallel, we constructed a M. smegmatis CRISPRi library (RLC11) to target all annotated Msmeg genes, similar to the Mtb sgRNA library.
RLC12 was transformed into M. tuberculosis H37Rv; RLC11 into M. smegmatis mc2-155.
We passaged both CRISPRi libraries for nearly 30 generations in the presence or absence of the CRISPRi-inducer anhydrotetracycline (ATc). At the indicated timepoints, genomic DNA was harvested and the representation of individual sgRNAs was counted using Illumina sequencing.
Here, we show sgRNA log2 fold-change values (L2FC) (plus versus minus ATc) over consecutive generations for sgRNAs targeting the gene you selected.
sgRNAs are color-coded based on their predicted strength from blue (strength=0; weak) to red (strength=1; strong).
In order to quantify gene vulnerability, data were subsequently analyzed with a hierarchical model at the sgRNA level (two-line model) and gene level (Hill curve). The vulnerability quantification is shown below. [More information]
You do not have permission to view notes.

