×
Error: Could not find gene with ID = 'MSMEG4770' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1585' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0425' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2083' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3655' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5808' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1708' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3235' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4718' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3987' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3116' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5464' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0300' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3400' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1282' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2936' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2204' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2687' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5989' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4066' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0295' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5847' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3707' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5256' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3828' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2482' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6769' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4057' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5443' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3940' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1086' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0412' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2763' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0704' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3630' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3366' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5241' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0663' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4110' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1622' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0881' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0532' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0374' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3520' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2069' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4770' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1585' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0425' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2083' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3655' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5808' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1708' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3235' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4718' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3987' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3116' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5464' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0300' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3400' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1282' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2936' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2204' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2687' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5989' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4066' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0295' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5847' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3707' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5256' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3828' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2482' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6769' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4057' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5443' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3940' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1086' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0412' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2763' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0704' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3630' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3366' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5241' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0663' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4110' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1622' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0881' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0532' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0374' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3520' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2069' and Strain = 'H37Rv'
MSMEG1381
ms1381
-
M. smegmatis
·
MC2-155
Sequence
Essentiality
Vulnerability
Notes (0)
help_outline
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence
help
DNA Sequence
CGTTGAGATTCGGCTCAAGACCCTTGGCGGCGAACAGTTCGCGGGCAGCTTCGAGCACGCGCTTACGGTTGCGCTCCGC
GTCCTTG CGCAGAGGCCGCTCCGGCGTCTCGGGGGCACTCACCCCGCCGAGTGTAATGCGGACAACATGAAAGCGGATTGACCTTATCCACTTATGCGGTTAGCTTAACTACTCGAAACTTTTT
GTCCCCG TTGCTCG GGGGCGT
GTTCCGG CGCCGGCGGCCCTGGTGAC
CTGCCGT CGGCTGCGGTCATCGAGTTCGGGGAAGGTAGCGATGACAAAG
GTGCTCG GTCGAATCTGGCTACCTGTGCTGA TCGTCGTCGCGGTCGCCGCGGGTGCACTGATCGTGATGAACGTGCGCACCGTGTTCGGGTCGAACCCTGTAGTGGTGACGGAGAAGACCTCGGACAACGCCGAGGACTTCAACCCGAAGGTCGTGACGTACGAGATCTTCGGCTCCGGCTCATCGGCCGTGATCAATTACATGGATCTCGAAGGCATGCCGC AGCGCGTCGAGAGCACACCGCTGCCGT GGAGCCTGACGCTGCAGACGACGCTGCCGT CGGTGATGCCCC ACATCATGGCCCAGGGTGACGGCGACAGCATCACGTGTCGGGTCACCGTCGACGACGTGGTCAAAGAAGAGAGGACCGCCACCGGCATGAACGCCGAAACCTTCTGCTAT GTGAAGGCAGCATGA
Protein Sequence
VLGRIWLPVLIVVAVAAGALIVMNVRTVFGSNPVVVTEKTSDNAEDFNPKVVTYEIFGSGSSAVINYMDLEGMPQRVESTPLPWSLTLQTTLPSVMPHIMAQGDGDSITCRVTVDDVVKEERTATGMNAETFCYVKAA
Vulnerability Assessment
help
You do not have permission to view notes.