Ms1720 (MSMEG1720)

Could not find gene with ID = 'MSMEG1098' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1485' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6870' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5648' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2587' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5650' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3963' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6691' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5050' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2679' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1987' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2380' and Strain = 'H37Rv'

MSMEG1720

ms1720

M. smegmatis · MC2-155

[AlphaFold] [Orthologs] [Phyre2] [UniProt] [MycoBrowser] [TnSeq DB] [SeqHub]

MC2-155 Coordinates:	1815873 – 1816148
Vulnerability Index (VI):
M. tuberculosis homologs	Rv3474, Rv3381c, Rv3325, Rv3186, Rv3184, [+ 12 remaining orthologs]
M. abscessus homologs

DNA and Protein Sequence help

DNA Sequence

>ms1720_MSMEG1720_dna

CACCAATCTGGGGCGAGAACCGCCCCCAGTCACCTACAGTCGAACGTCGCACCTGGAGGCGCCAGCCGGCCAAGGAGGCAGGAGCGGTACCCAGCGTGCGGGTTGCGCCGTGAAATTACTTCCGAGTCCGATACAAGCGCTGAAACTAACCACGGGGTCGGGTGTTCATGATCCGCCCCGGCGTGTCTGGAGATGGGAAGGATGGGCACGTGGGATCGAAGTCATCGAGGCGGTATCCAGACGAGCTGAAGGTGCGGGCGGTGCAGATGGTGGCCGATCTGCGCAGCGAGACAGTTTCGGAGTGGGAGGCGATGGGCCGGGCGCGTCGGTAAACGGTGCGCAAATGGGTCCGCCAGGCTGAGATCGACGCCGGCTCTCGGGCGGGGCAGACCAGCGAGGAATCCGAGGCAAGCTGCGCCGGGAGAACTCAAGCGGGCCAACGCGATCTTGAAGGCGGCCTCGGTGCCGCCGAGCTCGACCGGCCCTCTCAGTAG

Protein Sequence

>Ms1720_MSMEG1720_protein

VQMVADLRSETVSEWEAMGRVADLLGVGTAETVRKWVRQAEIDAGSRAGQTSEESEVLRKLRRENAELKRANAILKAASVFFAAELDRPSQ

Essentiality:

Call	Condition	Type	Source	Notes
Unknown	in vitro	CRISPRi	[Bosch & DeJesus et al. (2021)]
Non Essential	in vitro	TnSeq	[Dragset et al. (2019)]

You do not have permission to view notes.