Ms3660 (MSMEG3660)

Could not find gene with ID = 'MSMEG0573' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0340' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6735' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0437' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3901' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4795' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3487' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6775' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4848' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4467' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4150' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0616' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6385' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3680' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5384' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3483' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6732' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5322' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3672' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2875' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0302' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3679' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3241' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3248' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2483' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2576' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1880' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5385' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5841' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2541' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6797' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5079' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0345' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0672' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4895' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0540' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0501' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5041' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6841' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3403' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2874' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0103' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5679' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4450' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5089' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1833' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4047' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5459' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3772' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4537' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0233' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6534' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4880' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6474' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5065' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0690' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4048' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5901' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1872' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e753aa0>>.
Could not find gene with ID = 'MSMEG3348' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3057' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1464' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4028' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3247' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2364' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6547' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6328' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2891' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4575' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6003' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5601' and Strain = 'H37Rv'

MSMEG3660

ms3660

M. smegmatis · MC2-155

[AlphaFold] [Orthologs] [Phyre2] [UniProt] [MycoBrowser] [TnSeq DB] [SeqHub]

MC2-155 Coordinates:	3726341 – 3726784
Vulnerability Index (VI):	0.9840
M. tuberculosis homologs
M. abscessus homologs	MAB3939, MAB3979c

DNA and Protein Sequence help

DNA Sequence

>ms3660_MSMEG3660_dna

ACGAGCAGGGTGAGCAACTCGTCGCGACTGGCGACGTACCGGTAGACGGCCGACGACACCGGTCGCGGGCGACGGCCCGCATTGAGAGCCCCCCTCGGTCACGAGTCTCGACGATCGCCGCCTCGATGCGCACGCTTACCCACGCGGCCAGTAAACGAGATCATGAGGACATCAAAACGAGAGCACTGATCACATTTTGTGGACATCAAGAAGGGACATGACCAGGTATGACGAACCCGGCCCAGTGGCCCGCGCAGCCAATACGCTCATCCGTTGGCTGGCCGAACACGGCGTGAGCATCGCGGGTTCGACGGCGCTGCGGGTGCGTGGCAGGCGCAGCGGCAAGTTGCGCAGCGTGGTGGTCAACCTGATGACGGTCGACGGTCACCGGTACGTGGTCGCACCGCGCGGCGAGACCGAATGGGTCCGCAACGCCAGGGCCGCGGGTGTCGTGGAGATCGGACCGCGCCGGCGCCGCCGCACGGCACAGATCGCCGAGATGACGCGAAACCCACAAGCGCTATCTCGACCGGTGGTACTGGGAGGTCAAGGGGCACATGGCCGATCTGACGCCGAAGTCGTCGGCCGAGCAGTTGCGCGCGGCGGCACCGCACTGTTCGCACTCGTCGAGACGAGCTGA

Protein Sequence

>Ms3660_MSMEG3660_protein

MTRYDEPGPVARAANTLIRWLAEHGVSIAGSTALRVRGRRSGKLRSVVVNLMTVDGHRYVVAPRGETEWVRNARAAGVVEIGPRRRRRTAQIAEIPDDAKPTLLKRYLDRWYWEVKGHMADLTPKSSAEQLRAAAPHIPVFALVETS

Essentiality:

Call	Condition	Type	Source	Notes
Non Essential	in vitro	CRISPRi	[Bosch & DeJesus et al. (2021)]
Non Essential	in vitro	TnSeq	[Dragset et al. (2019)]

Vulnerability Assessment help

[Full list of passaging experiments]

Experiment (PMID: 34297925): We designed an M. tuberculosis CRISPRi library (RLC12) to target all annotated Mtb genes with single guide RNAs (sgRNAs) of varying predicted knockdown efficiencies. In parallel, we constructed a M. smegmatis CRISPRi library (RLC11) to target all annotated Msmeg genes, similar to the Mtb sgRNA library. RLC12 was transformed into M. tuberculosis H37Rv; RLC11 into M. smegmatis mc2-155. We passaged both CRISPRi libraries for nearly 30 generations in the presence or absence of the CRISPRi-inducer anhydrotetracycline (ATc). At the indicated timepoints, genomic DNA was harvested and the representation of individual sgRNAs was counted using Illumina sequencing. Here, we show sgRNA log2 fold-change values (L2FC) (plus versus minus ATc) over consecutive generations for sgRNAs targeting the gene you selected. sgRNAs are color-coded based on their predicted strength from blue (strength=0; weak) to red (strength=1; strong).

In order to quantify gene vulnerability, data were subsequently analyzed with a hierarchical model at the sgRNA level (two-line model) and gene level (Hill curve). The vulnerability quantification is shown below. [More information]

	M. smegmatis Reference Fitness Experiment	M. tuberculosis H37Rv Reference Fitness Experiment	M. tuberculosis HN878 Reference Fitness Experiment



	M. smegmatis Gene-Level Logistic Regression	M. tuberculosis H37Rv Gene-Level Logistic Regression (Most similar ortholog)	M. tuberculosis HN878 Gene-Level Logistic Regression (Most similar ortholog)


Vulnerability Index (VI)	0.9840
VI Lower Bound	-0.6760
VI Upper Bound	2.9160

You do not have permission to view notes.