Ms4286 (lipA) - Pebble

Could not find gene with ID = 'MSMEG4343' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49fdff3b0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa494380f50>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa494380440>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48c4dc2f0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4a01299d0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4a012bcb0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4a012a390>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48c4ddaf0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4943823c0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49417b170>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49fdfef00>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49455bfb0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46fd636b0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa465f3bfe0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49455a090>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46d904230>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa494381460>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48c4df110>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49434ba10>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49417a150>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa465f38fb0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e029ac0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa494381460>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4944a4650>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49429b6b0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e08b5c0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa494380530>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e0280b0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48c4dfc80>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa486e69af0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa494172240>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e6defc0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48733dcd0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46d9616a0>>.
Could not find gene with ID = 'MSMEG4286' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4a012a9c0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46d9071a0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4941ae030>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa486e69970>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa494382000>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e09c800>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4436c3f50>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46c5664b0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4941e04d0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4436c0530>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e6de210>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49434ab40>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46d904410>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e784aa0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e633ef0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e6ce870>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46d905700>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46d9633b0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa446753c20>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46c565670>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4941bdb50>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4436c02c0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e09c080>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46d9631d0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa46d904ef0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49c352e40>>.
Could not find gene with ID = 'MSMEG4356' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e785250>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa4a01b3c50>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa446753320>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e09c080>>.
Could not find gene with ID = 'MSMEG4155' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa48e09c740>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa446750fe0>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x7fa49fdfcd70>>.

lipA

ms4286

M. smegmatis · MC2-155

[AlphaFold] [Orthologs] [Phyre2] [UniProt] [MycoBrowser] [TnSeq DB] [SeqHub]

MC2-155 Coordinates:	4370637 – 4371581
Vulnerability Index (VI):	-3.6300
M. tuberculosis homologs	lipA
M. abscessus homologs	MAB1942c

DNA and Protein Sequence help

DNA Sequence

>ms4286_lipA_dna

CGTGTGGCGACCTGCGGCCCGCGCGCAAGATCGGCGCGATCGGCATCCGCGTCTCGCGCGCGACGACGCTGCACGGGTTCGCGCTCAACTGCGACTGCGACCTGTCGGCATCGCGGCATCACCGACGCCGGGGTGACACCGCGGAACTCGGCCGCCGCGTCACCGTCGACGAGGTCGCCGACCGGGTCGCCGCCGCGGTGTGCGACGCACTCGACGGCCGTTCGGCCATCACGAAACCCTGAACGTAGGATGAATCTGTGACTGTCAGGGACGCAAGGACTGGAGGTCCGCAACGCGCAGACCCCCATCGAGCGCAAGCCACCGTGGATCAAGACCCGCGCCAAGATGGGCCCCGAGTACACCGAGCTCAAGGGTCTGGTGCGGCGCGAGGGTCTGCACACGGTCTGTGAAGAGGCCGGAACATCTTCGAGAGGACCGCGAGGCCACTCGGCGGTGAACAGTGCACGCGGCGTTGTGAATCGACACCGGCAAGCCGGCCGACCTGGACCGTGACGAACCGCGCCGGGTCGCCGAGAGCGTGCAGGCCATGGGTCTGCGGTACTCGACGGTCACGGGCGTCGCACGCGACGACACGGCGGCGCCTGGCTGTACGCCGAGACCGTGCGCTACATCAAGCGCCTCAACCCCAACACGGGTGTCGAAACTTCAACGGCAACCCCGAGCAGCTCGAGGAAGTTTTCGAGTCGCGTCCGGAAGTGTTGGCGCACAACGTCGAAACCGCATCTTCAAGCGGATCCGCCCGGCTACGACCGCAGCCTCGCGGTGATCACCGCGGCGCGCAACTTCGGTCTGGTCACCAAGTCCAACCTGGTATGGGCGAGACCATCGACGAGGTGCGCACCGCGCTGCGTGACCTGCACGACGCCGGCTGCGACATCATCACCATCACGCAGTACCTGCGCCCGTCGCCGCGTCACCACCCGGTGGAGCGGTGGGTGCACCCCGACGAATTCGTCGAGCTCTCGGCCTGGGTCTCGGATTCGCCGGAGTGTTGGCCGGGCCACTCGTGCGGTCCGCGCGGGCAAGCTCTATGCACAGGCCGCGCGGGTGCGATTCGCAGATCAGCCCCCCGT

Protein Sequence

>Ms4286_LipA_protein

VTVVPEGRKLLRLEVRNAQTPIERKPPWIKTRAKMGPEYTELKGLVRREGLHTVCEEAGCPNIFECWEDREATFLIGGEQCTRRCDFCQIDTGKPADLDRDEPRRVAESVQAMGLRYSTVTGVARDDLPDGGAWLYAETVRYIKRLNPNTGVELLIPDFNGNPEQLEEVFESRPEVLAHNVETVPRIFKRIRPAFRYDRSLAVITAARNFGLVTKSNLILGMGETIDEVRTALRDLHDAGCDIITITQYLRPSPRHHPVERWVHPDEFVELSAYAEGLGFAGVLAGPLVRSSYRAGKLYAQAARVRFADQPPVS

Essentiality:

Call	Condition	Type	Source	Notes
Essential	in vitro	CRISPRi	[Bosch & DeJesus et al. (2021)]
Essential	in vitro	TnSeq	[Dragset et al. (2019)]

Vulnerability Assessment help

[Full list of passaging experiments]

Experiment (PMID: 34297925): We designed an M. tuberculosis CRISPRi library (RLC12) to target all annotated Mtb genes with single guide RNAs (sgRNAs) of varying predicted knockdown efficiencies. In parallel, we constructed a M. smegmatis CRISPRi library (RLC11) to target all annotated Msmeg genes, similar to the Mtb sgRNA library. RLC12 was transformed into M. tuberculosis H37Rv; RLC11 into M. smegmatis mc2-155. We passaged both CRISPRi libraries for nearly 30 generations in the presence or absence of the CRISPRi-inducer anhydrotetracycline (ATc). At the indicated timepoints, genomic DNA was harvested and the representation of individual sgRNAs was counted using Illumina sequencing. Here, we show sgRNA log2 fold-change values (L2FC) (plus versus minus ATc) over consecutive generations for sgRNAs targeting the gene you selected. sgRNAs are color-coded based on their predicted strength from blue (strength=0; weak) to red (strength=1; strong).

In order to quantify gene vulnerability, data were subsequently analyzed with a hierarchical model at the sgRNA level (two-line model) and gene level (Hill curve). The vulnerability quantification is shown below. [More information]

	M. smegmatis Reference Fitness Experiment	M. tuberculosis H37Rv Reference Fitness Experiment	M. tuberculosis HN878 Reference Fitness Experiment



	M. smegmatis Gene-Level Logistic Regression	M. tuberculosis H37Rv Gene-Level Logistic Regression (Most similar ortholog)	M. tuberculosis HN878 Gene-Level Logistic Regression (Most similar ortholog)


Vulnerability Index (VI)	-3.6300	-5.0370
VI Lower Bound	-4.4880	-5.4330
VI Upper Bound	-2.8160	-4.6600

You do not have permission to view notes.