×
Error: Could not find gene with ID = 'MSMEG6846' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1285' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4737' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4750' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4855' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2389' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4345' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6080' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0677' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6033' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5963' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2984' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3669' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3474' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4500' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3480' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6900' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6432' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6516' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3750' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5503' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5772' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1373' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3683' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4675' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1606' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3596' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2571' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2809' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1376' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0450' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0294' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2928' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0819' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4908' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0307' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3592' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2877' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3182' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4409' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4963' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6922' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6076' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5525' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3442' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4495' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2963' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0167' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6129' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6846' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1285' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4737' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4750' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4855' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2389' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4345' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6080' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0677' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6033' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5963' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2984' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3669' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3474' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4500' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3480' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6900' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6432' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6516' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3750' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5503' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5772' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1373' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3683' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4675' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1606' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3596' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2571' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2809' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1376' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0450' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0294' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2928' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0819' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4908' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0307' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3592' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2877' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3182' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4409' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4963' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6922' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6076' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5525' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3442' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4495' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2963' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0167' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6129' and Strain = 'H37Rv'
MSMEG5254
ms5254
-
M. smegmatis
·
MC2-155
MC2-155 Coordinates:
5347134 – 5347541
Vulnerability Index (VI) :
0.3760
M. tuberculosis homologs
M. abscessus homologs MAB1231
Sequence
Essentiality
Vulnerability
Notes (0)
help_outline
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence
help
DNA Sequence
TGGACCCGGTCGCGCGGCAGGCCTGGCAGTGGTTCGTCACCGAG
GTGCCGC AACGCTCGCTGCACAACTGGCAGAACGCCGCCGCCAAGGTGATCGCGGCGGATCTGCGCGGGCGCGTCGCGC
CTGCCGC CGGGCGCTGACCCGCCGCCTCGACA
ATCCCGC GA
GTCCTGC GCTGACCTGCGCTTGGCAGTGATTGGCAGCGTCTGGCGTCGATCTGGCAGTGGCTTGTGAGCAACCTCTGAGGTGTTCGACACGAAGCCTCGACACCGAGGAGCACCGAGGAGCCCTGAGGAGCCCGCC
ATGACCGCGATCACCACCCGGCCACTGTCCGATTCGACCGATTCCCTG TTGCGGTTCGCGTTGCGCGCCGACGCCACGGTGTGCGCGGGCGTCGGGTTGTTCACCGCGATGCTCG CCGACCCGCTGGCCCGCGTCGCCGGGCTGTCGGCGACGGCCGGATGGGTGATCGGCGCCGCGCTGGTGGGTTACGGAGCGTTGCTGT ACGTGCTCG CCGCCCTGCCCG CCATCCGCAAGGTCGGCGTCGCCGTCGCGACCGGCAACACGGTGTTCGCCGCCGCGTCCGTGACGGCCGTCCTCG CCGGGTGGCTGCCAC TGACCGGCGCGGGAACCGAACTGCTGCTCG GCTTCGTCGCCGCCACCGCCGCGCTGGCGTGGCTGCAGTACCGCGGAGTGCGCCGTCTGGCGTGA
Protein Sequence
MTAITTRPLSDSTDSLLRFALRADATVCAGVGLFTAMLADPLARVAGLSATAGWVIGAALVGYGALLYVLAALPAIRKVGVAVATGNTVFAAASVTAVLAGWLPLTGAGTELLLGFVAATAALAWLQYRGVRRLA
Vulnerability Assessment
help
You do not have permission to view notes.