×
Error: Could not find gene with ID = 'MSMEG3408' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1741' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0376' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1303' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG5983' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3650' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3178' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3101' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2859' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3944' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0644' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4870' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2564' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3790' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0029' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0438' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1289' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0048' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0067' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3784' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2900' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0053' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2573' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4408' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6306' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0032' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3138' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1691' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0156' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4463' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4556' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2389' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6947' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2379' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6080' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2372' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1085' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1645' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG2797' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6370' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3885' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6676' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3407' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4986' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0052' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG1840' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6709' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3864' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG6496' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG0672' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG3489' and Strain = 'H37Rv'
×
Error: Could not find gene with ID = 'MSMEG4293' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3408' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1741' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0376' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1303' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG5983' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3650' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3178' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3101' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2859' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3944' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0644' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4870' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2564' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3790' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0029' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0438' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1289' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0048' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0067' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3784' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2900' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0053' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2573' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4408' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6306' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0032' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3138' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1691' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0156' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4463' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4556' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2389' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6947' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2379' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6080' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2372' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1085' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1645' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG2797' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6370' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3885' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6676' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3407' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4986' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0052' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG1840' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6709' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3864' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6496' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0672' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG3489' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG4293' and Strain = 'H37Rv'
MSMEG6405
ms6405
-
M. smegmatis
·
MC2-155
MC2-155 Coordinates:
6476344 – 6477261
Vulnerability Index (VI) :
0.2730
M. tuberculosis homologs pirG , PPE35 , PPE24
M. abscessus homologs MAB0169c
Sequence
Essentiality
Vulnerability
Notes (0)
help_outline
Click the tabs above to view different types of data for this gene. The Vulnerability tab shows CRISPRi fitness data.
DNA and Protein Sequence
help
DNA Sequence
GGATCCGACGACGAATAGGTCGAAATTACCGGTGGACTGGGACGGAGCGACCGGGTGCGATATGGACGTCATCGGCAGCCAGGGTATCCGACCACC
CTCCCGC CCCTCGAATGCGACAGCAGGTCCAGGTCGCAATTCGCTCACGATTCAATCACGTCACTCTAGACACACTAGCCACACCCGTACCATCGATCACGTTGGCGCTCATGGGCTTCGCACGATCCGTCCGTAGCCGCTGACGAAGTTGTTCGGAGCACTCCGAGCAGTTGATATGCAGTCCATGTATTGAGGAGACTTCC
GTGCCGA ACCGCCGTCGACGCAAGCTCTCGACAGCCATGAGCGCAGTCGCCGCAGTGGCCGTCGCAAGTCCAGTCGCCCTGATTGCCGC AACTCAGCATTCCCCC GCACCCCAACACCGCGAGTTCACCCAGGCCGCGCTGGTCACCGACCTCCCCG GCGAGCTGATGTCCGCGCTTTCGCAGGGCCTGTCCCAG TTCGGCATCAACCTGCCGC CCATGCCAT CGCTGACCGGTGGCGCCGCGACGCCGTCGCTGGCCTCCCCG ACACTGACCTCCCCC GGTCTGGCCTCCCCT GGTTTGACCTCCCCG GGCTTGACCCCAGGTTTGACGCCGGGCTTGACGACGCCGTCGCTGACCGACCCCGGTCTGACCAACCCGGCCCTGACCAATCCGGCGCTGACCAGCCCCGACGGCCTGACCTCGCCGGGTCTCACGACGCCGAGCCTGACCAGCCCGGGCCTGACCACGCCGGACGCGTCGCTGGGCGCCACGCCGTCGCTCACGGATCCGGGTCTGACCAACCCCGCACTGACCACGCCGTCGCTCACCACTCCCGG CCTGGCCACGCCCTCGACCGGTCTGACCACCCCCGGCCTGGATCCGTCCCTG ACGCCGATCTCCAACGCCGCGGGCCTGCCCG CACCCGGTGAGGTGCCGA TCTCGGCGCCGGTCGGCCTGGATCCGAGCCTGGGGACCTATCCGATCCTGG GTGATCCGTCGCTCGCGACCATGCCTGCCGC GAGCACGGGAGGCGGCGGCCTGTTCGGTGATCTGTCCGCCGCGGCCGATCAGCTGGGCGCGGGCCAGGCGATCGACCTGCTCA AGGGCATGGTGCTCCCGG CCATCACCCAGGCCATCCAGTCCGGCGCCCAGGCGGCCCCGGCCGCCGCACCGGCACCCGTGCCGC CGCCTGCCTG A
Protein Sequence
VPNRRRRKLSTAMSAVAAVAVASPVALIAATQHSPAPQHREFTQAALVTDLPGELMSALSQGLSQFGINLPPMPSLTGGAATPSLASPTLTSPGLASPGLTSPGLTPGLTPGLTTPSLTDPGLTNPALTNPALTSPDGLTSPGLTTPSLTSPGLTTPDASLGATPSLTDPGLTNPALTTPSLTTPGLATPSTGLTTPGLDPSLTPISNAAGLPAPGEVPISAPVGLDPSLGTYPILGDPSLATMPAASTGGGGLFGDLSAAADQLGAGQAIDLLKGMVLPAITQAIQSGAQAAPAAAPAPVPPPA
Vulnerability Assessment
help
You do not have permission to view notes.