Error: Could not find gene with ID = 'MSMEG0040' and Strain = 'H37Rv'

Error: Could not find gene with ID = 'MSMEG0043' and Strain = 'H37Rv'

Error: Could not find gene with ID = 'MSMEG6054' and Strain = 'H37Rv'

Error: Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x778491bcba40>>.

Error: Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x77848f38b470>>.

Could not find gene with ID = 'MSMEG0040' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG0043' and Strain = 'H37Rv'
Could not find gene with ID = 'MSMEG6054' and Strain = 'H37Rv'
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x778491bcba40>>.
Error in passages view: Field 'id' expected a number but got <SimpleLazyObject: <django.contrib.auth.models.AnonymousUser object at 0x77848f38b470>>.

MSMEG1022 (MSMEG1022)


Species:	M. smegmatis
Strain:	MC2-155
PATRIC Annotation:	-
Synonyms:
M. tuberculosis homologs
M. abscessus homologs
Gene Start:	1091864
Gene End:	1092091
Vulnerability Index (VI):
VI Lower Bound:
VI Upper Bound:

[AlphaFold] [Orthologs] [Phyre2] [UniProt] [MycoBrowser] [TnSeq DB] [Gaia]

Essentiality:

Call	Condition	Type	Source	Notes
Unknown	in vitro	CRISPRi	[Bosch & DeJesus et al. (2021)]
Non Essential	in vitro	TnSeq	[Dragset et al. (2019)]

DNA and Protein Sequence help

DNA Sequence

GTAGCCGAGCCGCCAGCACGCCGTAGCCGAGCAACACGATCCAATAAGCGCCAGGCCGGCCGCGCCGACGAGCCAGCCGCCGCAGAAGCAGCACATCGCGGCGAACATCGCCTTGCGGGGGCCGTTGCGGTCCACCCACACACCGCGGCCGAGAGGCCGAGCATGACGTGGTGAACGGCAGCGCGCTGAGGAGGGGCGCCGGAAGACGCTCCACGAGTAGGCCGCGCCGACGGAGAGATGGATCGACAACGCCGCCGGTGGCACCAGCCACCGACTCCAGCCAGGTGGCGCGACGATGCGCTCAAGAACGGGCCGACGCGGTGGGCGCACTGTTCCGGTCGCCTTTCGTTGTCGACGCGATCACGAGAGCGGTGTGCGCGTCACCGACGGCGCCGGTGTGGCGAGGCACACACGACGCAAGGACAATAG

Protein Sequence

MDRQRRRWHQPPTPARWRDDALPAQERCCGRRGGRTVRPCGHPWPFVVDAITRAVCASPTAPVWRGTHDAIPRGQ

Gene not present in the reference CRISPRi library.

MSMEG1022 (MSMEG1022)

Essentiality:

DNA Sequence

Protein Sequence

Specific References

General References